Dreaver Treadmill
USER’S MANUALPLEASE READ ALL THE INSTRUCTIONS IN THE MANUAL CAREFULLY BEFORE ASSEMBLY AND USE OF THE TREADMILL.PLEASE KEEP THIS FOR FUTURE REFERENCE.1
CONTENTCONTENT ——————————————————————————————————————————-IMPORTANT SAFETY PRECAUTIONS ———————————————————————————ASSEMBLY INSTRUCTION—————————————————————————————————–GROUNDING METHODS ———————————————————————————————————OPERATION GUIDE ———————————————————————————————————–GETTING STARTED GUIDE —————————————————————————————————SAFETY EXERCISES ————————————————————————————————————-WARM-UP EXERCISES ———————————————————————————————————-MAINTENANCE INSTRUCTIONS ——————————————————————————————-2 2
IMPORTANT SAFETY PRECAUTIONS
WARNING: Before starting any exercise program, consult with your physician or health professional especially any
person who is above 35 years old or has experienced some health problems before. We cannot be responsible for any injuries
or accidents due to the above reasons. Don’t turn the power on until you finish assembling the treadmill and covering the
motor.
ATTENTION:
1. When using this treadmill, ensure you attach the safety pull pin rope to your clothes or belt.
2. Do not plug anything into any parts of this equipment, as it may cause damage.
3. Position the treadmill on a clear, level surface. Do not place the treadmill on thick carpet as it may interfere with proper
ventilation. Also, do not place the treadmill near water or outdoors.
4. Never start the treadmill while you are standing on the walking belt. After turning the power on and adjusting the speed
control, there may be a pause before the walking belt begins to move, always stand on the foot rails on the sides of the frame
until the belt is moving.
5. Wear appropriate clothing when exercising on the treadmill. Do not wear long, loose fitting clothing that could become
caught in the treadmill. Always wear running or aerobic shoes with rubber soles.
6. Keep children or pets away from the treadmill during operation.
7. Do not do exercise until 40 minutes after a meal.
8. The treadmill is specifically for adult use, mature children who use the treadmill must have adult supervision.
9. Always hold the handrails when initially walking or running on the treadmill, until you are familiar with the use of the
treadmill.
10. The treadmill is for indoor equipment, do not use outdoor. Position the treadmill on a clean, level surface. The treadmill
is made using special equipment, please do not remodel or copy others.
11. The power cord of motorized treadmill is specialized. If the power cord is damaged, please purchase it from distributor or
contact our company directly.
12. If the treadmill should suddenly increase in speed due to an electronics failure or the speed inadvertently increased, the
treadmill will come to a sudden stop when the pull pin is disengaged from the console.
13. Do not connect anything in the middle of the power cord, extend the power cord or replace the power cord plug. DO
NOT Stack weight objects on the power cord or place the power cord near high temperature heat, prohibit use the porous
socket,
otherwise
it
will
cause
fire
or
electric
shock
injury
accident
because of poor contact.
14. When the treadmill is not being used, the power cord should be unplugged and the safety pull pin
removed.
15. The treadmill is for home use only.
16. The treadmill maximum user weight is 100kgs
17. Please do not overuse the treadmill. Overuse can lead to an injury and do not misuse the treadmill, for your safety.
18. When the treadmill is not being used, please keep the safety pull pin in a safe place to avoid the other use.
ATTENTION: Please confirm that the complete assembly is as required above and all bolts are locked. Do the following operations after checking everything is OK. Before you use the treadmill, please read the instructions carefully. As above drawing, you can adjust lifting angle by changing pin’s position. There are 3 sections adjust key to be used.
ASSEMBLY INSTRUCTION
TOOLKIT
No. Description
Qty.
Remark
1 Screw 2 Screw
4
M8*30 length 25
2
M4*15
3 Wrentch
1
5#
4 Wrentch
1
6#
5 Wrentch3
13-14# 1
3
Grounding MethodsThis product must be grounded. If it should malfunction or breakdown, grounding provides a path of least resistance for electric current to reduce the risk of electric shock. This product is equipped with a cord having an equipment-grounding conductor and a grounding plug. The plug must be plugged into an appropriate outlet that is properly installed and grounded in accordance with all local codes and ordinances.DANGER Improper connection of the equipment-grounding conductor can result in a risk of electric shock. Check with a qualified electrician or serviceman if you are in doubt as to whether the product is properly grounded. Do not modify the plug provided with the product if it will not fit the outlet, Please find a proper outlet installed by a qualified electrician.. This product is for use on a nominal 220V circuit and has a grounding plug. Make that the product is connected to an outlet4 4
having the same configuration as the plug. No adapter should be used with this product.Operation GuideWIDOW DISPLAY 1. “TIME” window displays the exercise time, forward timing from 0: 00-59: 59, when the timing reaches 59: 59, the walking machine will slow down and stop running and display “End”, it will enter standby after 5 seconds of complete stop State; the countdown counts down from the set time to zero. When the countdown reaches 0: 00, the walking machine stops slowly and stops running and displays “End”. It enters the standby state after 5 seconds of complete stop. 2. “DIS.”window displays the distance of movement. The forward count is from 0.00-99.9, the overflow is cleared and counted up from 0, and the reverse count is decremented from the set value to zero. In the countdown mode, when the countdown reaches At 0 o’clock, the walking machine stops at a steady speed and displays “End”. It enters the standby state after 5 seconds of complete stop. 3. “CAL.” Window displays the caloric value of athletes. It counts from 0-999 when counting forward, clears when overflow occurs and starts counting from 0. When counting backwards, it counts down from the set value to 0. In the countdown mode, when the countdown reaches 0, the walking machine stops running at a slow speed and displays “End”, and enters the standby state after 5 seconds of complete stop. KEY FUNCTIONS 1. “PATTERN” is the mode selection key: Press this key in the standby mode to cycle through “0: 00”, “10:00”, “1.0”, “50” (“0: 00″ is the manual mode, ” “10:00” is the time countdown mode, “1.0” is the distance countdown mode, and “50” is the calorie countdown mode.) When selecting various modes, you can use the speed and slope plus and minus keys to set the relevant countdown. Value, press the “ON / OFF” key after setting is completed to start the walking machine. 2. “START / STOP” is the start / stop key: When the power is on and the safety lock is engaged, press this key at any time to start the running of the walking machine. During the movement, you can use this button to stop the running of the walking machine and reset it to zero. 3. “SPEED +” and “SPEED-” are speed plus and minus keys: standby state, used to adjust the set value. It is used to adjust the speed after startup. Its adjustment range is 0.5 km / time. When it is continuously held for more than 0.5 seconds, it will automatically increase or decrease. OPERATION DURING EXERCISE 1. Pressing the deceleration key will reduce the running speed of the walking machine. 2. Pressing the accelerator will increase the running speed of the walking machine. 3. Press the stop button to decelerate to stop running.MANUAL MODE 1. In the standby state, directly press the “START / STOP” key, the walking machine starts running at a speed of 1.0 km / h; other windows start counting from 0, press the “SPEED +”, “SPEED-” keys to change the speed . 2. In the standby state, press the “PATTERN” key to enter the time countdown mode. The “TIME” window displays “10:00″ and flashes. Press the SPEED”+” and SPEED”-” keys to set the exercise time. The fixed range is: 5: 00–59: 00. 3. In the time countdown mode, press the “MODE” key to enter the distance countdown mode. The “DISTANCE” window displays “1.0” and blinks. Press the SPEED”+” and SPEED”-” keys to set the movement distance and the distance setting. The range is: 1.0-99.0. 4. In the distance countdown mode, press the “M” key to enter the calorie countdown mode. The “CAL” window displays “50” and flashes. Press theSPEED”+” and SPEED”-” keys to set the calories. The range is: 10-990. 5. Select one of the three countdown modes and press the start key after the setting is completed. The treadmill will start running after a delay of 3 seconds. Press the SPEED”+” and SPEED”-“keys to adjust the speed; press the stop key to5 5
walk the machine Slowly stop running.DISPLAY SWITCHING1. After the walking machine is started, press the speed plus key to switch to the automatic window display; the display window is switched every 5 seconds; the speed, time, distance, and road distance are displayed in turn, and the real-time motion data is displayed. 2. After the walking machine is started, press the “PATTERN” key to switch the display window. Press in sequence: speed, time, distance, calories, and tour display.DISPLAY RANGE OF EACH VALUE
Setting parameters Time(minutes:seconds) Speed (KM / H) Distance (km) Heart rate (beats / minute) Calories (kcal)
Initial 0:00 1.0 0 P 0
Set initial value 10:00 1.0 1.0 N/A 50
Setting range 5:00-59:00 1.0-6.0 1.0-99.0 N/A 10-990
Display range 0:0059:59 1.0-6.0 0.0099.950-200 0999
·.POWER SAVING MODE This system has a power saving function. In the standby state, if there is no key command input within 10 minutes, the system enters the power saving mode, and the display is automatically turned off. Press any key to wake the system again. SHUTDOWN The treadmill can be turned off at any time by turning off the power switch, so that the walking machine will not be damaged.TROUBLE SHOOTING 1. The electronic meter does not display after the power is turned on. Possible cause: The communication cable from the electronic meter to the control is not plugged in or the transformer is burnt out. Each core is fully inserted. Or the communication line is bad (broken or broken), you need to reconnect or replace the wire; or replace a transformer to see. 2. If the electronic meter displays “E01” after running, it is a signal communication failure. Possible cause: The communication between the electronic control and the electronic meter is blocked. Check the connection between the electronic meter and the lower control communication line to ensure that each core is fully inserted. Check whether the connecting cable between the electronic watch and the controller is damaged, and replace the connecting cable. 3. If the electronic meter displays “E05” after explosion protection, check whether the power supply voltage is lower than 50% of the normal voltage, please retest with the correct voltage specifications; check if the controller has a strange smell, replace the controller; check the motor Whether the cable is connected well, reconnect the motor cable. 4. If the electronic meter displays “E02” after running, there is no sensor signal, the possible reasons are: no motor signal input is detected for more than 5-8 seconds, the motor cable is not plugged in or the motor is defective. 5. If the electronic meter displays “E06” after running, it is an overcurrent protection. The possible cause is that the current exceeds the rated load, the system is self-protecting, or a part of the treadmill is stuck, which causes the motor to fail to rotate and the load Excessive weight, excessive current, the system protects itself; adjust the treadmill and start again. Another is to check whether there is over-flow noise or burning odor when the motor is running, and replace the motor; or check whether the controller is burning odor, and replace the controller; Re-test the voltage specifications. 6. If the motor does not run after pressing the start key, the reason may be that the related motor of the control motor is abnormal, the control fuse is damaged or falling off, or the motor cable is not plugged in, or the IGBT on the control is burned out. Whether the circuit is plugged in and connected properly, check whether the fuse on the electrical control is intact, install or replace it; check whether the motor wire is loose, and plug the motor wire. Use a multimeter to measure whether the IGBT on the lower controller is burnt out and short-circuited. Replace or replace the lower IGBT on the lower controller. CALORIE CALCULATION FORMULA 70.3 × V (Km / h) × t (h) × (1 +?%) Calories burned for each kilometer run with ascension to 0 is 70.3 calories.Getting started guide If you are above 35 years old, or have any health problems, even this is your first time to do fitness exercise, please consult doctor or professional before use it. Before do exercise, please stand on the side to learn how to operate, such as start, stop and speed adjustment. After that stand on the plastic deck of the treadmill board, catch hold of the handrail, start by 1.6–3.2 km/h low speed, stand straight, look66
forward, start slowly by taking a few steps. After adapting, you can adjust the speed to 3–5 km/h and keep doing about 10 minutes, then stop.
SAFETY EXERCISE
Please stand on the side to learn how to operate, such as speed and incline, until you become familiar, then you can start do
exercise. Walk 1 km by constant step need about 15-25 minutes, please record it in fact. And walk 1km by 4.8 km/h need
about 12 minutes. If you can do it easily by few times, then can adjust the high speed and incline, and go on to do 30 minutes,
you can take a good exercise. Before do slow walk exerciseplease remember it is for your health and can not irritable.
AMOUNT OF EXERCISE
SHORTCUT—-The best way to save time is do 15-20 minutes exercise.
Warm up 2 minutes by 4.8 km/h, and adjust the speed to 5.3 km/h and 5.8 km/h, continue do exercise by this two speeds.
Then add 0.3 km/h per 2mins speed increase, until you feel breathing quickened but not breathe hard. Keep this speed to do
exercise, if feels uncomfortable, please reduce 0.3 km/h. Leave 4 minutes to reduce speed at last. If you fell it is hard to
strengthen exercises by increase speed, then you can choose the way of increase incline slowly, it also can strengthen
exercise.
CONSUMPTION OF HEAT—-This way can really consumption the heat.
Warm up 5 minutes by 4–4.8 km/h speed, then add 0.3 km/h per 2 minutes increasing speed, you can do 45mins on the
speed that you feel it is comfortable and challenge. In order to strengthen do exercise. You can do 1 hour by this speed and
add 0.3 km/h speed when you heard some business advertisements, and return the speed back when go to next program, so at
this period, the heat will be consumed enough. At last keep 4 minutes to reduce the speed.
EXERCISE FREQUENCY
Target is 3–5 times per week, do 15-60mins each time. It is better to make a time schedule, do not accord to your favor. You
can get the strenuous exercise degree through adjusting speed . We’d suggest that do not set incline when start do exercise.
Please consult professional doctor before you do exercise. They can help recommend exercise rate/intension and time
according to your age and health condition. When running, if you feel chest tightness or chest pain, irregular Heartbeats,
short of breath, dizziness or other unwell, please stop immediately! And consult doctor before you continue to exercise. If
you often use treadmill, you can choose normal walk speed or jog speed.
If you have no experience or can’t make sure the best testing speed, you can reference below standard:
Speed 1-3.0 km
weak constitution people.
Speed 3.0-4.5 km
sedentary or not often exercise people.
Speed 4.5-6.0 km
walking quickly people.
Speed 6.0-7.5 km
fast walk people.
Speed 7.5-9.0 km
jogger.
Speed 9.0-10.0 km
intermediate speed runner.
More than 10.0 km
excellent runner.
ATTENTIONIt is suitable for walker to choose less than or equal to 6 km speed.
Warm-up Exercise It is better to do some warm-up exercise. Warm the muscle easy stretch, so use 5-10 mins to warm-up. Then stop and according below method to do stretch exercise for five times, and each foot do 10 seconds or more every time. After running, do those stretch exercises again 1. Reach Down Knees slightly bent and body slowly bent forward, back and shoulders relax, trying totouch toes. Keep 10-15 seconds and relax. Repeat 3 times(See picture l). 2. Hamstrings Stretches: Sitting on a clean cushion, put one leg straight, the other inward and close to the inside of the straight leg. Try to touch your toes with your hands. Keeping for 10 to 15 seconds, and relax. Repeat 3 times for each leg (See picture 2). 3. Crus and Feet Tendon Stretches: Standing with two hands on the wall or tree, one leg behind. Keeping your legs straight and the heel on the ground, tilt to the wall or tree. Keep 10 to 15 seconds, and relax. Repeat 3 times for each leg (See picture 3). 4. Quadriceps Stretches: Keeping your balance with your left hand holding on the wall or table, then stretch your right heel toward your buttocks slowly, until you feel very tense in the front of your thigh. Keep10 to 15 seconds, and relax. Repeat 3 times for each leg (See picture 4). 5. Sartorius (Inner Muscles of the Thigh Muscle Stretches: Sitting down with your soles opposite and knees outward Pull your feet toward your groin Keep 10 to 15 seconds and relax. Repeat 3 times (Seepicture 5). Maintenance Instruction WARNINGPlease make sure pull out the treadmill’s power plug before cleaning or maintaining the product. CLEANSINGGeneral cleaning will greatly prolong the treadmill’s life.Keep your treadmill clean by dusting regularly. Be sure to clean the exposed part of the deck on either side of the walking belt and also the side rails. This reduces the build up of foreign material underneath the walking belt. Make sure your shoes77
are clean. The top of the belt may be cleaned with a wet soapy cloth. Be careful to keep liquid away from inside the
motorized treadmill frame or from underneath the belt.
WARNINGAlways unplug the treadmill from the electrical outlet before removing the motor cover. At least once a year
remove the motor cover and vacuum under the motor cover.
This treadmill’s walking belt and deck are equipped with a pre-lubricated, low maintenance deck system. The belt/ deck
friction may play a major role in the function and life of your treadmill, thus requiring periodic lubrication. We recommend a
periodic inspection of the deck.
We recommend lubrication of the deck according to the following timetable:
Light user (less than 3 hours/ week)
Every 60 days
Medium user (3-5 hours/ week)
Every 45 days
Heavy user (more than 5 hours/ week)
Every 30 days
We suggest you buy lubricating oil from local distributors or contact our company directly.
Please follow the instructions carefully. If you are unsure about anything contact a technician or the manufacturer.
Place treadmill on a level surface. Run the treadmill at approximately 6-8 km/h, observe the runningbelt deviate condition.If the belt has drifted to the right, unplug the safety lock and power switch, and turn the right adjusting bolt 1/4 turn clockwise, then insert the power switch and safety lock, re-start the treadmill and observe the running belt to see if it deviates. Repeat the above steps until the running belt is aligned in the middle. See picture A If the treadmill belt is swerving to the left, unplug the safety lock, turn off the power, then with the left adjusting bolt clockwise rotation 1 / 4 laps, and turn on the safety lock and power on to make treadmill running, checking the deviation of the treadmill belt. Repeat the above steps until the belt centered. See picture B The treadmill belt will gradually relax after above steps or after a period of time using, unplug the safety lock, and turn off the power, with the two adjusting bolt clockwise rotation 1 / 4 laps, and turn on the safety lock and power to make treadmill running, then standing on the belt to confirm the tightness. Repeat the above steps until the belt moderate tightness. See picture C
8 8
GEBRUIKERSHANDLEIDINGLEES ALLE INSTRUCTIES IN DE HANDLEIDING ZORGVULDIG DOOR VOOR DE MONTAGE EN GEBRUIK VAN DE LOOPBAND. BEWAAR DIT AUB VOOR TOEKOMSTIGE REFERENTIE.
INHOUD:INHOUD BELANGRIJKE VEILIGHEIDSMAATREGELEN MONTAGE-INSTRUCTIES STABILISERING METHODES HANDLEIDING VOOR DE BEDIENING HOE GA JE AAN DE SLAG VEILIGHEIDSOEFENINGEN DE WARMING-UP ONDERHOUD INSTRUCTIES2
BELANGRIJKE VEILIGHEIDSMAATREGELEN WAARSCHUWING: Voordat u met een trainingsprogramma begint, dient u uw arts of gezondheidswerker te raadplegen, vooral elke persoon die ouder is dan 35 jaar of eerder gezondheidsproblemen heeft gehad. Om de bovenstaande redenen kunnen wij niet verantwoordelijk worden gehouden voor enig letsel of ongeval. Schakel de stroom niet in voordat u klaar bent met het monteren van de loopband en het afdekken van de motor. LET OP: 1. Als u deze loopband gebruikt, zorg er dan voor dat u het veiligheidskoord aan uw kleding of riem vastmaakt. 2. Sluit niets aan op enig onderdeel van deze apparatuur, aangezien dit schade kan veroorzaken. 3. Plaats de loopband op een helder, horizontaal oppervlak. Plaats de loopband niet op een dik tapijt, aangezien dit de ventilatie kan belemmeren. Plaats de loopband ook niet in de buurt van water of buitenshuis. 4. Start de loopband nooit terwijl u op de loopband staat. Na het inschakelen van de stroom en het afstellen van de snelheidsregeling, kan er een pauze zijn voordat de loopband begint te bewegen; ga altijd op de voetrails aan de zijkanten van het onderstel staan totdat de band in beweging is. 5. Draag geschikte kleding wanneer u op de loopband traint. Draag geen lange, loszittende kleding die in de loopband verstrikt kan raken. Draag altijd hardloopschoenen of aerobicsschoenen met rubberen zolen. 6. Houd kinderen en huisdieren uit de buurt van de loopband als deze in werking is. 7. Doe de oefening pas 40 minuten na een maaltijd. 8. De loopband is specifiek bedoeld voor gebruik door volwassenen. Oudere kinderen die de loopband gebruiken, moeten onder toezicht van een volwassene staan. 9. Houd altijd de handleuningen vast wanneer u voor het eerst op de loopband loopt of rent, totdat u vertrouwd bent met het gebruik van de loopband. 10. De loopband is bedoeld voor gebruik binnenshuis, niet buitenshuis. Plaats de loopband op een schoon, horizontaal oppervlak. De loopband is gemaakt met speciale apparatuur; verbouw of kopieer geen andere. 11. Het netsnoer van de gemotoriseerde loopband is gespecialiseerd. Als het netsnoer beschadigd is, koop het dan bij een distributeur of neem rechtstreeks contact op met ons bedrijf. 12. Als de loopband plotseling in snelheid toeneemt als gevolg van een elektronicafout of als de snelheid per ongeluk wordt verhoogd, zal de loopband plotseling tot stilstand komen wanneer de trekpen uit het bedieningspaneel wordt gehaald. 13. Sluit niets in het midden van het netsnoer aan, verleng het netsnoer en vervang de stekker van het netsnoer niet. Stapel GEEN gewichten op het netsnoer en plaats het netsnoer niet in de buurt van hoge temperaturen, verbied het gebruik van het poreuze stopcontact, anders kan dit brand of elektrische schokken veroorzaken vanwege een slecht contact. 14. Als de loopband niet wordt gebruikt, dient u de stekker uit het stopcontact te halen en de veiligheidstrekpin te verwijderen. 15. De loopband is alleen voor thuisgebruik. 16. Het maximale gebruikersgewicht van de loopband is 100 kg. 17. Gebruik de loopband niet te veel. Overmatig gebruik kan tot letsel leiden en voor uw veiligheid mag u de loopband niet verkeerd gebruiken. 18. Bewaar de veiligheidstrekpin op een veilige plaats wanneer u de loopband niet gebruikt, om ander gebruik te vermijden.LET OP: Bevestig dat de volledige montage is zoals hierboven vereist en dat alle bouten zijn vergrendeld. Voer de volgende bewer-kingen uit nadat u hebt gecontroleerd of alles in orde is. Lees de instructies zorgvuldig door voordat u de loopband gebruikt. Net als in de bovenstaande tekening kunt u de hijshoek aanpassen door de positie van de pen te veranderen. Er zijn 3 sectiesleutels om te gebruiken.MONTAGE-INSTRUCTIES3
Stap 1: Open de verpakkingsdozen, de machine uitgevoerd, volgens de richting van pijl A. Til de kolommen en wijzerplaat.
Stap 2: De pijler en dial-up, neem een kruishendel schroef, met 5 sleutels in B. Aanscherping in C, de andere kant van de methode.
Stap 3: Haal de M*15 en een halfcilindrische schroef eruit. Haal met nummer 5 op de sleutel E, D en F met 14 sleutels eruit, aan de andere kant hetzelfde.
Stap 4: Houd de Handvatten bij beweging vast, gedwongen rotatie, rotatie op een geschikte locatie
Stap 5: De installatie van de machine, sluit het netsnoer aan, zet de schakelaar aan, haal de stopknop eruit en op de gele locatie in het midden.
GSrtoabuinlidsienrginMg Methetohdosden eTcinDeggtlouheleenieauiclatskdecrtap-tircurardpirdocicaoersrtrordcioddcndhuerauieuncnnoratcgrvcsenetmteeegdrnrnmoeowetaoleeaueitmtnagtoishdnswrtetoosreaobrlemumulredklndiumathldegoncpeinircnetinornagaergut.liashsnpDumnciedlclgoeuteoeeedrtgsdisrevst.ael.esokalnTklIntaeefkhionnneeepfide.rtelpneaIeomsnallnerhuetdodlscogreieeiietunktsrlmniilitawjcdcrknusioostecssmorcvtehdhvrasaobieeon.nlnceofgskeuracpees.nahnlcncunTohtogegkhrifleogi.iefssneDutklediotpitnrottvirierspoanenclrndtblhoooeurevdpnecaeusa,tnercckgoeithdasenroidpboskegeprwu.quenrinNsiuoitknc,gipehpgersegiepirtmkraauneottbs.deucstiGltonmowionsEdpuaeitiVcttattnhliocAeegetnteAaootnptanpRhcrcsdoaotmnetvrdordeiiadvedsttreeheepoermseakrlpnvoeeavjipetgunarepeeingdsrekaltndwtaeyaheanaawinplnmosieipfsfjlqiizuatncauleriesetlaieetliaptesenrusmddgtuwveeerarae-ïneenanneltsadrse-isdntgksatgestrtalalrrolnuiaoenucdipeuctinprieenvnddnadogirfenoeoasond–rgfr qmtuDacaoAtlnipNtfeiaeGusdrtE,aeuRllsevucinttIrdwmitcipeijaferenonlptpoeoarrfssscheeoerntnvdanipcseeptcomatpiroaacnanotnoigtffaoctyethdoieunisesatqgarueleliienpirsnmetnaedlndloetoue-ogbrrdrto.eaVuesnnerdtgoaiennkwdgwehcraeolntinhifeidecturedcetetrhodseretepcekarlkeonekdrrturedicscitueielibtnsi.ijpnhraeotprpeisrrkolydougfcretoluecnatldrseichde.sthDnoiocektn.ionCthhmeetcoskdtoiwfpycitohtnh-ae pDluitgpprorodvuicdteids bweidthoetlhdevporoordguecbtruikifoitpweeilnl nnoomt fiintatahle2o2u0tVle-tc,iPrclueiatseenfhinedefat epernopgeeraaorudtelestteinksktearl.lZedorbgyearvqouoarldifaitehdeetlpercotdriucciat nis. aan.gTehsliostpenroodpuecet nissftooprcuosnetaocnt ma entodmezinealfld2e2c0oVnficgiurcrautiiteaanlds dheasstaekgkreoru. nBdijindgit pplruogd.uMct amkaegthgaeet nthaedapprotedruwctoridsecnognenbercuteikdt.to an outlet4 4
having the same configuration as the plug. No adapter should be used with this product. OHpAerNatDioLnEGIDuiIdNeG VOOR DE BEDIENING:
S1.CHHeEtR”WTMIIMDDOEIS”WP-LvDAenIYSstPerLtAoYont de trainingstijd, voorwaartse timing van 0: 00-59: 59, wanneer de timing 59:59 bereikt, zal de loop1m. a”cThIiMneEla”ngwzianmdoerwgadainsplolapyesn tehnesteoxpeprecnisme ettimreen,nefnorewnazradl htiimj “iEngndf”rowmeer0g:ev0e0n-.5S9t:an5d9-,bywnhaen5 stheceontidmeinnvganreeaecnhevsoll5e9d:ig5e9s,totph.e wSatalkati;nhgetmaaftcehllienne twelitlal fsvloawn ddeoiwngnesatnedldsettoipjdrtuont nniunl.gWaanndndeeisrphleatya”ftEenllden”,0i:t0w0 iblelreeniktet,rsstotapntddbeyloapfetenrde5mseaccohnindeslaonfgczoamampleentestsotoptp Smtaetter;etnhneencoeunnwtdoorwdtn”Econudn”tws edeorwgengefrvoemn. Htheet sgeatattiimnedetostzaenrdob.yW-toheesntatnhdencao5unstedcoowndnenrevaacnheesen0:vo0l0le, dthigeewstaolpk.ing machine stops s2lo. w”DlyISa.n”dvesntosptesr rtuononntindge abnedwdegisipnglasyasfs”taEnndd.”D. eItveonotrewrsaathrtesesttaenlldinbgy isstavtaena0ft,0er0-599se,9c,odnedosvoefrlcooomppwleotredtstgoepw. ist en opgeteld vanaf 20., e”n dDeIaSc.h”tewrwinaadrotswe tdeilslpinlgaywsotrhdet vdeisrtlaaangcde voafnmdoevinegmeesntetl.dTehweafaordrwe naradarcnouuln. tInisdefrcoomun0td.0o0w-9n-9m.9o,dtuhse, wovaenrnfeloerwheist acflteeallreendOanmd c0ouuunrtebderuepiktf,rsotmopt0d,ealnodoptmheacrheivneermseetceoeunnct oinsstdaenctreesmneelnhteeidd efrnogmeetfht e”Esnedt “vwaleueer. tHoezt egraoa.t iInndtehestacnodubnyt-dtoowesntanmdondae5, wsehceonndtehne cvoaunnetdenowvonllreedaicgheesstoApt. 0 o’clock, the walking machine stops at a steady speed and displays “End”. It enters the standby state
a3f.te”rC5AsLe.c”oVnednssotefrcgoemefptldeetecsatloopri.sche waarde van atleten weer. Het telt van 0-999 bij het vooruit tellen, wordt gewist wanneer er
3s.p”raCkAeLis.”vWaninovdeorwflodwispenlabyesgtihnet tcealtoelrliecnvvaalnuaefo0f. aBthijlehteetsa. cIht tceoruuintttselflreonmte0lt-9h9et9awf hveann dceouinngtiensgtefldoerwwaaradr,dcelenaarasr w0.hIenndoevceorfulnotwodcocwunrs-manoddusst,arwtsancnoeuenrtihnegt afrfotemlle0n. 0Wbheerenikcto,usntotipntgdebalockowpmaradcsh,initecdoruanaittsodpoweennflraogme stnheelhseeitdveanlugeeteoft0″.EInndt”hewceoeur,netndogwaant minoddee, wsthaenndbtyh-etoceosutanntdonwa n5 srecaocnhdeesn0v, atnheeewnavloklilnegdimgeascthoipn.e stops running at a slow speed and displays “End”, and enters the
sTtaOnEdTbySFsUtaNteCaTftIeErS5 seconds of complete stop.
1.”PKATERYOFOUNN”CisTdIeOmNoSdusselectietoets: Druk op deze toets in de standby-modus om door “0:00”, “10:00”, “1.0”, “50” te bladeren
1(.”0″:P0A0T”TiEs RdeNh”anisdmthaetimgeomdeodseulse,c”t”io1n0:k0e0y”:isPrdeesms tohdiusskveoyorinhetht eafstetallnednbvyanmdoedteijdto,”c1y.c0le”isthdreoumgohdu”0s:v0o0or”,h”e1t 0af:0te0ll”e,n”v1a.0n”d, e”5a0f-”
(s”t0a:nd00e”n”is50th”eismdaenmuoadl umsovdoeo,r”he”t1a0f:t0e0ll”enisvathnecatilmoreiecëon.u)nWtdaonwnenermuovdeer,sc”1hi.l0l”enidsethmeoddiisstealnecceteecrotu, knutdnotwu ndemsnoedleh,eaidnden”d5e0″heilslitnhge
cpalluosrieen cmoiunngtdeobwrunikemnotdoee.t)seWn ohmendseerleelcetvinagntevacroiuonutsdomwondeins,teyostuellceann. Wusaeartdhee, sdpruekedopandde “sAloApeNp/lUusITa”nd-tometisnnuasdkaet ydse tionssteeltlitnhge
rieslevvoaltnotocidouonmtddoewlono. pVmalauceh,inperetsessttharete”nO. N / OFF” key after setting is completed to start the walking machine.
22..””SSTTAARRTT // SSTTOOPP”” iissdtehestsatratr/t s/tostpo-ptoketesy: :AWlshdeensttrhoeopmowiseinr gisesocnhaaknedldtheen shaeftevtyeilliogchkeiidsseslnogtaigseidng, epsrcehsasktehlids, kkeuyntaut aonpyetlkimmeot-o
smtaernt tthoep druenzenitnogetsofdrtuhkekwenalokmindgemloapcehnidnee.mDacuhriinneg ttehleatmenodvreamaieennt.,Tyiojduencsandeubseewthegisinbgukttuonnt utodsetzoepktnhoeprguenbnruinikgeonfotmhehewtalolkpienng
mvaanchdieneloaonpdmraecsheitniet tteosztoeprop.en en op nul te zetten. 33.. “”SSPPEEEEDD ++”” eannd”S”PSEPEEDE-D” -z”ijanrsenseplheeeidd pplluuss eanndmminitnouestskeeny: ss:tasntda-nbdybtyoesstatatne,d,ugseebdrutoikatdojmusdt ethiengseesttevladleuwe.aIatrdise uaasendtetopaasdsjeuns.t
tHheetswpeoerddtagfetebrrusitkatrtoump. dIetssandejluhsetimd aeannt rtaenpgaessiesn0n.5a khemt o/ptsimtaret.eWn. hHeent iint sitselcboenretiinkuiosu0s,l5ykhmeld/ tfiojdr. mAlosrehetthcaonn0ti.n5usleacnognedrsd,aint w0,i5ll
asuetcoomndaeticwaollrydtinvacsretgaesheoourddene,cwreoarsdet. het automatisch verhoogd of verlaagd.
BEDOIEPNEIRNAGTTIOIJNDEDNUSRDINE GTREAXIENRINCGISE 11..PDroesosrionpg dtheeddeceecleelreartaietitoonetks etey dwruilklkreend,uwceortdhtedreunlonoipnsgnseplheeeidd ovfanthdeewloaolkpimnagcmhiancehvienrel.aagd. 22..PDroesosrihnegt tghaespaecdcaealelriantoter dwriulkl kinencrweaosredtthdee rluoonpnsinngelhspeiededvaonfdtheelowopalmkaincghimneavcehrihnoeo. gd. 33..PDrreusks tohpedsetosptobpuktntoopn otomdteecveelertrraatgeetnoosmtoptersutonpnpinegn.. HANDMATIGE MODUS
1.DrMukAiNn dUeAsLtanMd-ObDy Etoestand direct op de “START / STOP” -toets, de loopmachine begint te lopen met een snelheid van 1,0 km /
a1o2u2k3″n.t.1.n.hadII.DiDen0nnpfrrd”prluttuaweehhwkkrsreeiehteni.ineessvndDrttsedoaa.edrnennwunPesddsktrsktetbbeaionrsyjsynspdtisapdassbdrpt-fttehtbaaetegeecyttrSeiletonmS.t,,PuonDPpdEoeneErrdisEtnrueituEeDansktscnesDgotd”oltt”pf+eyhporl”eodlppd+eeme”redn”neSPetsv0APoSs”a,EeTPPanpttEAEnThsardfDeeTEE”s0TDMRS”s”,SEP+NdtO”TRhE”r-“DAeu”NEekkEnt”RD”oeS”oSTey-“PptPtoos/EtEmde-eoSE”entEsTeDdD”onoOeSmmtk+”PePae-“rEfd””dy,tetEeesthk”olDtStmeetreioayjPtodt+is,iEsndaem”teifEnu,hnttes”eeDogtSlhcmvsmw-Ptoeo”ioEajudoekddlneErxkeuitDbeaiyndsnfreso-stcgtw”eetwtiaosemtosnneogtpcdaeeitemhnetlcinslmangheoeensninedntnage…efeoeHsTH.omtsteTpahehttneaethdevndrveeftsaeesiesps”nxnnntTre.eseueedtdIHlenbdMehrereneaa.t”rEiifennTdvs”iggtIektaJewnenaDissiwidttsn”es5a:idirgj:5nzose”0s:ipwegD0t0efee-tIe0l5dnSl”d–i9i.1Tns:o0gpA50:fliN090an10y:.C.t”s00eE0w”s”k.1teme0gel:erl0e/een0fhnt.”;
3H. eItnbtehreeiktimise1,c0o-u9n9,t0d.own d4i.spDlrauyks i”n1d.0e”manoddubslivnokosr.
mode, press the “MODE” key to enter the distance countdown mode. The “DISTANCE” window hPerteassftethlleenSPvaEnEdDe”a+fs”tanadnodpSdPeEtEoDe”ts “-“M”koemysdteo mseotdtuhse vmooovr ehmeteanfttedlilsetnanvcaen acnaldortiheeënditsetaonpceenesne.ttHinegt.
T”hCeArLa”ng-veeinss:t1e.r0t-o9o9n.t0”. 50″ en knippert. Druk op de SPEED “+” en SPEED “-” toetsen om de calorieën in te stellen. Het bereik is
41.0I-n99t0h.e distance countdown mode, press the “M” key to enter the calorie countdown mode. The “CAL” window displays
“55.0S”ealencdtefelar seheens.vPanredses tdhreieSaPfEteElmDo”di+e”n darunkd oSpPdEeEsDta”rtt-o”ets kneaydsattodeseint sttheellicnagloirsievso.lTtohoeidr.aDngeeloiso:p1b0an-9d9b0e.gint te lopen na een
5v.eSrteralegcint govnaeno3f stehceonthdreene. Dcorunktodpowden SmPoEdEeDs “a+n”d epnreSsPsEtEheDs”t-a”rttokeetysenafotemr dtheesnselthtienigd aisancotemppalsesteend;. DTrhuek torpeaddemsitlolpwtoieltlssotamrt
rduennmiancghainfteetrealadtelnalyopoefn3. Ssetocponladnsg. zParaemssmtheet lopSePnE. ED”+” and SPEED”-“keys to adjust the speed; press the stop key to
5 5
SCHAKELEN VAN HET DISPLAY 1. Nadat de loopmachine is gestart, drukt u op de snelheid plus toets om over te schakelen naar de automatische vensterweergave; het weergavevenster wordt elke 5 seconden gewisseld; de snelheid, tijd, afstand en wegafstand worden om beurten weergegeven en de realtime bewegingsgegevens worden weergegeven.WEERGAVE VAN ELKE WAARDE:ENERGIEBESPARINGSMODUS Dit systeem heeft een energiebesparende functie. Als er in de stand-by toestand geen toetsopdrachten binnen 10 minuten wordt ingevoerd, gaat het systeem naar de energiebesparende modus en wordt het display automatisch uitgeschakeld. Druk op een willekeurige toets om het systeem weer te activeren.UITSCHAKELEN De loopband kan op elk moment worden uitgeschakeld door de stroomschakelaar uit te zetten, zodat de loopmachine niet beschadigd raakt.PROBLEEMOPLOSSING 1. De elektronische meter wordt niet weergegeven nadat de stroom is ingeschakeld. Mogelijke oorzaak: De communicatiekabel van de elektronische meter naar de besturing is niet aangesloten of de transformator is doorgebrand. Elke kern is volledig ingebracht. Of de communicatielijn is defect (kapot of kapot), u moet de draad opnieuw aansluiten of vervangen, of een transformator vervangen om te zien. 2. Als de elektronische meter “E01” weergeeft na het draaien, is er een signaalcommunicatiestoring. Mogelijke oorzaak: De communicatie tussen de elektronische besturing en de elektronische meter is geblokkeerd. Controleer de verbinding tussen de elektronische meter en de onderste communicatielijn om er zeker van te zijn dat elke kern volledig is ingestoken. Controleer of het verbindingskabel tussen het elektronische horloge en de controller is beschadigd, en vervang de verbindingskabel. 3. Als de elektronische meter na explosiebeveiliging “E05” weergeeft, controleer dan of de voedingsspanning lager is dan 50% van de normale spanning, test opnieuw met de juiste spanningsspecificaties; controleer of de controller een vreemde geur heeft, vervang de controller; controleer de motor Of de kabel goed is aangesloten, sluit de motorkabel weer aan. 4. Als de elektronische meter na het draaien “E02” weergeeft, is er geen sensorsignaal, de mogelijke redenen zijn: geen motorsignaalingang wordt gedetecteerd gedurende meer dan 5-8 seconden, de motorkabel is niet aangesloten of de motor is defect. 5. Als de elektronische meter “E06” weergeeft na het draaien, is dit een overstroombeveiliging. De mogelijke oorzaak is dat de stroom de nominale belasting overschrijdt, het systeem zelfbeschermend is, of een deel van de loopband zit vast, waardoor de motor niet draait en de belasting overgewicht, overmatige stroom, het systeem beschermt zichzelf; pas de loopband aan en begin opnieuw. Een andere manier is om te controleren of er overstroomgeluid of een brandgeur is wanneer de motor loopt, en de motor te vervangen; of controleer of de controller een brandgeur heeft en vervang de controller; Test de spanningsspecificaties opnieuw. 6. Als de motor niet draait na het indrukken van de starttoets, kan de reden zijn dat de betreffende motor van de regelmotor dat wel is abnormaal, de besturingszekering is beschadigd of valt eraf, of de motorkabel is niet aangesloten, of de IGBT op de besturing is doorgebrand. Of het circuit is aangesloten en correct is aangesloten, controleer of de zekering op de elektrische bediening intact is, installeer of vervang deze; controleer of de motordraad los zit en sluit de motordraad aan. Gebruik een multimeter om te meten of de IGBT op de onderste controller is doorgebrand en kortgesloten. Vervang of vervang de onderste IGBT op de onderste controller.CALORIEN BEREKENINGSFORMULE 70.3 × V (Km / h) × t (h) × (1 +?%) Calorieën die worden verbrand voor elke kilometer hardlopen met een stijging naar 0 is 70,3 calorieën.Hoe ga je aan de slag Als u ouder bent dan 35 jaar of gezondheidsproblemen heeft, zelfs als dit de eerste keer is dat u aan fitnessoefening doet, dient u een arts of professional te raadplegen voordat u het apparaat gebruikt. Ga voordat u gaat trainen aan de zijkant staan om te leren hoe u moet werken, zoals starten, stoppen en snelheidsaanpassing. Ga daarna op het plastic dek van de loopband staan, pak de leuning vast, begin met 1,6-3,2 km / u lage snelheid, sta rechtop, kijk vooruit, begin langzaam met een paar stappen. Nadat je je hebt aangepast, kun je de snelheid aanpassen naar 3-5 km / u en ongeveer 10 minuten blijven doen, en dan stoppen.6
fmoVGrairEanawkuIaaLttl.ersIdDjsGe,,abHtsalhtiEraeenIrfnaDtt skasStaluoOonnpwEd.jeFleyEbzNebijgykIiNantnanGtkesnintamgaenatoofmeewfetenselteenrp.esLn.oAhpoefetnem1r eaktdmhaepmttieantpgcp,oanyrasoatuatnoctmaenstteaadpgjahuaesnet,fttzhooenalgsspesveneeedelrht1eo5id3-2-e5-n5mhkeimnllui/nthegnashnnodoedkkig,e,etonptoddtaeoteijrnehgveeatrbitnoroufuetiwt1ed0.
SPeEedxlAneoenaFerhlscnEoeei,plTslmeesiYntn.oagWe1nEtadkXaaumlnoEkepnRrba1irtCsjhesk4kIeeSm,en8snEiekibdnnmyegdt/cmoouooenlroeegsnaathgaraonennuvtdhmeseoetenrwetp1d32ta0ontmemhoeiepnidtneuvuarteoatbentooenrnu,,uotdswdua1icn5ggh-.ke2Auza5osnlsntmsuduphiheneeeeeuitddntgeaigsesno,medepnadlkieennkaicoeesleletiifnjpekrerne,ieickneuokgnnredtpldiblaoiaaetyarnorikn.ukeVaefbonareockzcrtuid.ojnanmAtt.nedudofeeaewnmn,aidlllakainanrg1,kzkutamhnmetnebuylydooe4oup.h8tocrgakaienmnsis/nnhtegalrnhgteeadeiaddot
ASWTeayHSOVsghxboHhMneeaHoeouOpeenlOrreuwlnOOlmcE.cightRniAaaRVUaes1gvTrnudieTlm2EeNdsClp,dtCraEaemuaTvUinU02nkLfaogvi.TenOlTHn23fzmige–nuaao–FEemkeidatmnngIelmEmt—-iDssuosndXt/.t0oueuthaTTeeIDE,dtntso3feRhpvRcheeneeybkAeeofexCbobemryrbtmIeheuniINe2mrjsSo4ef/csmtc4Iogn.EoetiuN8a,rse,ei8wntmennGphiakl.ks,aeebdiamjBmyhrtnloskeev/i2pethe,tii/oofetsr,mokuepeesooalra,dliataeemnmnnevsoaiunddoinensttloooeicdeycatejnkroeiddsfebmrmeljdessatyounennedesfwsieeofeunbtioellr,scgehhewtwtuesaeheefdpaebnniieot0ddanletiktisrm.ils1eal3envpa5eanegyeveaxn-ksroeen2ivpehm,srud,0eraostdcv/rhstgftmhseioseeeoistr.ernoneeeikmnngrr5Llekcu.1innebt3aento5aaprnenddeae-vkls.e2o,reaaemr0oeatt5dho0rxs4/,jmti3he,ueddn3mrsieakrganctketmniuismtmqnsunhdteueu/eees./nit5lumncehuh.aeks8ee.ibalgeinWlendteknhor5rmaelt,siiecdvr8ctp/ehohvhiebkdtseae,emuu4larfdtcthcmomoa/oenardnsguinobyenste,dtiepomunnbwbeuti,uleenerirednejnecdfghaalmdointietanrnmhoaaatgkeeliauten,ldtrhahenxeaesnatnenadtsirr.undeonmdcdteIe.idgefsnhleKcohte.ayaedmreoonbideednuayzpnaneetodtfioitheetetnhwrilmddiislrsekoertietli.istiwe3tpHjsazk0inoebesoeetnmlueselhdhdpo.iaventemredodudereedtlddzeantseeoo-s.., strengthen exercises by increase speed, then you can choose the way of increase incline slowly, it also can strengthen
eVxeErRciBseR.UIK VAN WARMTE COOpNdSeUzeMmPaTnIieOrNkaOn FdeHwEaArmT–te –echTthwisowrdaeyn cvaenrbrreuailklty. Ocopnwsaurmmpetnio5nmthienuhteeant.met een snelheid van 4-4,8 km / u, voeg vervolgens W0,a3rmkmu/pu5pemr 2inmutiensutbeyn t4o-e-n4e.8meknmde/hsnsepleheedid, ttohee,nuakdudnt04.53 mkmin/uhtepnedro2enmopinduetessneilnhceriedadsiinegu cspomeefdo,rtyaobeul ceannuidtdoag4e5nmdivnisndotn. Othme stpeevedersthteartkeyno,udfoeeelaaitnilsicchoamamfosrbteawbleegianngd. Jcehaklulennt g1eu. uIrnmoredt edreztoe ssntreelnhgeitdhednoedno eenxe0r,3ciskem. Y/ ouusncealnhediod t1oehvoouergbeny athlsisjespzeakedeliajkned aadddv0er.3tenktmie/shhsopoeredde,wenhedne synoeulhheeidartdersuogmgeevbeunswinaensnseaedr vjeerntaisaermheetnvtso,lgaenndderepturorngrtahmemspaegeadatb, adcuks iwnhdeenzegpoetroiondeexwt oprrdotgdraemw,asrmo taet thviosldpoeerniodde,vtherebhrueiaktt.wHilolubdetcenonssloutmtee4d meninouutgehn.aAant loamst dkeeespne4lhmeiidnutetevsetrolargeednu. ce the speed. EXERCISE FREQUENCY
TOarEgFeEt NisIN3-G-5SFtiRmEeQs UpeErNwTeIeEk, do 15-60mins each time. It is better to make a time schedule, do not accord to your favor. You
cHanetgdeot ethl eiss3tr-e5nkueoeurspeexrewrceieske, ddeogereeelktehrkoeuergh15a-d6j0usmtiinngutsepne.eHde.tWiseb’detseurgogmesetetnhatitjddsochneomt saetteinmcalikneen,wwheeenssntaiertt dinouewxevrcoiosred.eel.
PUleaksaen dceoninssupltanpnreonfdeesstiroaninailngdsogcrtaoard kbreifjogreen dyooour ddeosnexelehreciidsea.anThteeypascsaenn.hWeleprardeecnomaamneonmd geexeenrchieslelinrgatien/itnetsetnesllieonn waanndneteimr ue
abcecgoirndtimngetttorayinoeunr. Ragaeadapnledegheeaelnthprcoofensdsiitoionenl.eWarthsevnoorurdnantiungg,aaift tyraoiunefne.eZl eckhuenstnetniguhthneelpssenobrijchheetsat apnabienv,eilrernegvuanlatrraHineianrgtsbsenaetls-,
shheoirdt /o-finbterenastihte,itdeinzz-itnijedsospobraositshevranunuwwelelle,fptiljedaesnegsetzoopnidmhemidesdtoiaetsetlayn!dA. Anlds ucotinjdsuenltsdhoect thoarrdbleofpoerneeyeonubeckolnemtinmueentdogeexveorecliosep.dIef
ybooursotfotefnpiujnseotpredaedbmoirlslt,,yeoeun ocnanrecghelomoasetigneohrmaratsllwaga,lkkosrptaedeedmoirghjoegids, pdeueizde.ligheid of ander onwel voelt, stop dan onmiddellijk! En
Ifrayaoduplheeagveeennoaerxtspveroioerndcaet uordcoaonrg’tamatamkeetsturraeintehne. Abelsstutevsatainkglosoppebeadn,dyeonugceabnruriekfte,rkeunncteubdeelonworsmtaanledalordo:p- of jogsnelheid kiezen.
Als je geSepneeerdva1r-i3n.g0hkembt of niet zeker wweeetawkactodnesbtietustteiotnesptsenoeplhlee.id is, kun je de onderstaande norm raadplegen:
SnelheidS1p-e3e,0d k3m.0-=4.m5eknmsen met een zwsaekdegnetsateryl. or not often exercise people.
SnelheidS3p,e0e-4d,54.k5m-6.=0skemdentaire of nietwvaalakkinsgpoqruteinckmlyenpseeonp. le.
SnelheidS4p,e5e-6d,06.k0m-7.=5sknmel wandelende fmasetnwseanl.k people.
SnelheidS6p,e0e-7d,57.k5m-9.=0sknmelle mensen lopjoegn.ger.
SnelheidS7p,e5e-9d,09.k0m-10=.0jokgmger.
intermediate speed runner.
SnelheidM9o.0r-e10th.0ankm10=.0gkemmiddelde snelehxecidesllleonpterr.unner.
Meer daAn T1T0,E0NkmTIO= NuitsteItkiesnsdueiltoapbelre. for walker to choose less than or equal to 6 km speed.
AANDACHT! Het is geschikt voor wandelaars om een snelheid van minder dan of gelijk aan 6 km te kiezen. Warm-up ExerciOHmd1Ise1stti.v.ePeoitBientRWpseruuilyesbktAaieageentbnRcitdnekmthMoetaeeamreaeDrIc.rrtNcoAoobo1omGwep0fdrntSdntoeseeeOierednscwnEergoounaFmonnb:rKEpdmnkeeweNnlinenonweaiInewgNreoa.ëm,sfrGSnmdmimstn:ololie-geicputtgsehhhphodrtoo.etagedslDfnyxeeeotbeneosbeornitcnegrdnivegnesaoottnecthles.ahgeetnWndrtdeedohlxeatiecaecrbonhrmhrodn.cadledViaotsxyehemepreresesswrltnlcmaaaoaingadsrwungameisedlizyncfaerdolaeeembrmkeesofenpianetvhtisfaeeeyoafrndortsgiiervntmewrogomeeraemtesacnrn,dkhvo,akg,ipnjeebsfnldboaiikjocekeeugukaesedwrcenao.hr,no5erdfr-kuo1ougso0eihttefomentdeunoisilnrcnde1shgek0oertkousnsedenwrteeec,ralogsdarneomxodben,-srnttuus,roippyekra.innn5mTdng-ho1oeet0rneoneetonupcrhobtoeeresn. Kdeeetepn1en0-a1a5nsteecroankdens.aHndourdel1a0x-.1R5espeecaotn3detnimveass(tSeeneopnitcsptuarne. lH).erhaal dit 3 keer (zie afbeelding l). 22.. RHeakmoesfterinnigngseSntrveotocrhedse:hSaimttsintrginogsn: azitctleenadnocpuesehniosnc,hopount kounseseleng, ésétnrabigeehnt,gtehsetreoktht,ehreitnawnadredreannadarcbloinsneetnogteh-e riincshitdeenodficthhet bsitjradiegbhitnlneegn.kTanryt vtaontohuetcgheystoruekrtteobeesewn.itPhroyboeuerr uhwantdesn.eKn emeeptinuwg fhoarnd1e0ntaoan15tesreackoennd. sH, oaundd1r0eltaoxt. 1R5epseecaotn3dteinmveasstfoerneoancthsplaeng. (HSeerehapaicl t3urkeee2r).voor elk been (zie afbeelding 2). 33.. CCrruussenanvdoeFteenept eTeesnsdtroenkkSetnr:eStcthaaens:d Smtaetntdwinege hwaintdhentwoop dheanmdusuor noftbhoeowma,leleonrbtereene,acohnteer.leHgoubdehjeinbde.nKeneerepcihntg eynoudre hleieglsosptrdaeigghrot nadn,dkatnhteelhneaealr doen mthueurgorfobuonodm, t.iHltotuod t1h0etowta1l5l soercotrnedee.nKveaestpen10onttosp1a5n. sHeecrohnadasl,3aknederrveolaoxr. eRlkepbeeaetn3(ztiime aefsbfeoerldeiancgh3l)e.g (See picture 3). 44.. QQuuaaddrriciceeppssstSretrkettzcihcehs:uiKt:eheopuidnguwyoeuvrenbwaliacnhctemwetituhwyloinukrelrehfatnhdatnedgehnodldeimnguuornotfhteafwela, lelnosrtrteakblvee,rtvhoelngesntsreutwch ryeocuhrterrihgihetl hlaeneglztaoawmarndaayrouuwr bbuitltloenc,ktsostdloawt ulyz,iucnhteilrgyoguesfpeaenlnveenryvoteenltsienidnethveoofrrokannttovfaynouuwr thdiijg.hH. oKuedep1010totto1155 sseeccoonnddesn, avnadst reenlaoxn.tsRpeapne.aHt e3rhtiamale3s kfoerereavcohorleeglk(bSeeeenp(izciteuarefb4e)e.lding 4). 55.. SSaarrtotoriruiuss(i(nInnenrelirjkMe supsicelreesn ovfanthdee TdihjisgphierMstursecklkeen zSicthreutcith:egsa: zSiitttteinngmedtouwwn zwoliethn tyeoguernosvoelresenokpnpioesëintenaaanrd bkunieteens.oTuretwk aurwd vPoueltlenyonuararfeuewt ltioews 1a0rdtoyto1u5rsgecrooinndeKneaeapn 1en0 otonts1p5ans.eHcoenrhdasal daitn3dkreeelrax(z.ieRaefpbeeaetld3intgim5)e.s (See
picture 5). MOanidneterhnoaundcseinInstsrturcutcietison WCWhHLoAoAEuuRdAAdNtR.NuIRSwNSECIGlNIHoNoGUIpGWPbIlaNeIGnNadGesGens: c:eAmhrZlaoagolokercngmeledesearounvnoreoeirnrorepgreiungdwliealgiltolmiulnuaggtdtrietzeghaaselattelfdtykretekeplaeesrdrvotmovelfoanifnnlseldgn’dsu.etupZhlroeoowvrotgarpeenebraradpdvnelmoduloogiurlolibd’tpseahbflteaiouftnredseh.teoactpalebncalozonineoitnntaglgcietjsokhtreavlmaedlrtealevidnnoetgoaeerlindnv.aiantnguhthehetetdpperrkoodaduaunccttw.reeienrisgztijodfeonnvdaenrKeep your treadmill clean by dusting regularly. Be sure to clean the exposed part of the deck on either side of the walking
belt and also the side rails. This reduces the build up of foreign material underneath the walking belt. Make sure your shoes7 7
de loopband en ook de zijrails reinigt. Dit vermindert de opeenhoping van vreemd materiaal onder de loopband. Zorg ervoor dat je areschcoleeanne.nTschheootonpziojnf.tDhe bboevltenmkaynt bveancdleearniemd wkainthwaorwdeent scohaopoyngcelomthaa. kBt emectaerefnunl attote kzeeepalcihqtuigide daoweaky. Zfororgmerivnosoidredatht er mogteoernizveldoetirsetaodf minilhleftroanmdeerosrteflrovman udnedgeermneoatothristheerbdellto. opband of onder de band terechtkomt. WWARANAIRNSGCHUAWlwINayGs: Hunapaluagltitjhdedteresatedkmkeilrl vfaronmdethloeopebleacntdricuaitlhoeuttslteotpbceofnotraectrveomoordvaint gu dtheemmoototrokracpovveerrw. iAjdtelret.ast once a year remVeorvweijtdheer mmointostrencos véeérnaknedervpaecrujuamar udnedmerottohrekampoetnorstcoofvzeuri.g onder de motorkap. De loopband en het loopvlak van deze loopband Thziisjntrueiatgdemruisllt’smwetaelkeinnvgoboergltesamnederdde,cokndaererheoquudispaprmeddwekisthystaeepmre.-Dluebrwicriajtveidn,g ltouwssemn adientbeannadnceen dhetckdeskykstaenme.enThbelabnegltr/ijkdecrkol friscpteiolennminaydepfluanycatiemeanjolervreonlesdiunutrhveafnuunwctiloonopabnadndli,fewoaafrydoouorr ptreeraioddmieilkle, tshmuesrrinegqunioridnigg ipse. rWioedricadleunbreiecnatpioerni.oWdieekreeicnosmpemcteinedvaan pehrieotddieckinaasnp.eWctieornadoefnthaeandeocmk.het dek te smeren volgens het volgende tijdschema: WLeircehctoemgemberunidkelur b(mricinadtieorndaonf t3hueudre/cwkeaeckc)oerldkieng60todathgeenf.ollowing timetable: LiMghitddueslegrr(olteesgsetbhraunik3erh(o3u-r5s/uwure/ewk)eek) elke 45 dageEn.very 60 days MZedwiaurme guesberru(i3ke-5r (hmoeuerrs/dwanee5ku)ur / week) elke 30 dageEnv.ery 45 days HeWaveyraudseenr u(maaonresmtheaenro5liheotuerks/opweenekbi)j lokale distribuEtveeurrys o3f0rdecahytsstreeks contact op te nemen met ons bedrijf. Volg de instructiesWaaensduagcghetisgt dyooour.bAulys luunbireict azteiknegrobielnftroomverloiectaslndeiesmtribcuontotarsctoorpcmonettaecetnouinrsctaolmlatpeaunryofdidreecfatlbyr.ikant. Please follow the instructions carefully. If you are unsure about anything contact a technician or the manufacturer.Place treadmill on a level surface. Run the treadmill at approximately 6-8 km/h, observe the running Plaats de loopband op een vlakke ondergrond. Laat de loopband draaien met ongeveer 6-8 km / u,belt delveitaotep cdoenadfiwtiiojkne. nde conditie van de loopband. AgkdltAgseadDndItadSIpodSTubmRootunfffrwereaeneonesoeeellehwoteeealrssdildvvtteewlvsreainnpenpnbkhlhtiniateddiireotddjbeergoppeaaeeehttgstknieecootmeseaaru,ttrlaii,ehdileleiiopbll,ccnttbblnttfaogoiieeeuroasrttmbdeenngteagtgeenhcuunse.hndohaltlpnggeeaarkeoatoyrrvpepmRmnescaad,ineedfoiwdmoeghacbndleadaeseamleiufnmpAnnhkhBannalcositlpbtzdgtbswylaanwsvthtticddeieaoordeeakhladelbakeeidlealaamvletrnezertklepeh,rtdrgnrhgoelsibdlretklreioreeoetajesrtrtctdfddelurlrusnrheiteltlaoctkoeiolewnaeaedthnesns-oirethpekaogtasiasedtelndsdithidblplii.oamtdfasltoiismenserseaealresnZontlnbmelntiogotelrsnhtkipgvrsedisgoicutycnofedmojeiwesbrah,ttvnkh1lgbgmtbtoa,hnlaftpsilheatee,oaosadtmadopoenilko/hdrebgoldsniltfuudnlsdcvnoterwtweaeremdjitt4uaetaketilgiuthenablst.1rnBangli,riev,teetpspejlertt.eaHl/gsmhreky.urtaia4aasslnerditbnsRttaive,ntpndn,ne,.terokua,etdreueontteesgomdeHu,hnnulondlrrni,elpnndtoovaatndanrrtteinbtgetehimoadaaalnnopxuttrdiklloaeoknilanhprentltlrrooltakglwtiauocagddaadbnaithpaldoejfpavalngmteeaeenpediothcneplipeontdoeefdevbeeudcltaserprdtedfrrnohnl.aeo,vksekrfueloebdce.aniZttadvoowelundloebeertktbbhbaieipledhnhlsnavsgegiwooenonsbotncasteneepeeiihettrvnsovahveinfgrirndleneevtcedesouef,tvuepghabseaiusbeeoentteotdegatotytehdrseweinasvsmbnmhnslvwtlnreemttaaittevteeeteldoaegerhlehensfoieplsed1onaeiptislshtcnettedcsllrraisni/ltoahsliedgg,sn4.eeekitgibdfrsiastoiehrrlngSweduauoheesarrbeekcaresoutpteaslknenfnnAnooeniyaisievaelenpniidtnntdlutnp.idrdjhvifteaad1engskketitlyppfltsraapnnveoeilneipgeveitrntidntr/pnegrcrclhenehohnrtemeogereotek4dndegarewe-unbnc,o-ntedrkpeiefl-tabtpencaawhl,reneothpterCdtsoltweisutthwoo,crteepacdikniargdteosimncohennjwoshudfeigttwfdne,esftttrriideiauitftemtsnnlhchrtdesigohndeeet… rechtsom, en zet de veiligheidsvergrendeling aan en zet de stroom aan om laat de loopband draaien en ga dan op de riem staan om de strakheid te bevestigen. Herhaal de bovenstaande stappen totdat de riem matig strak zit. Zie afbeelding C.8
[xyz-ips snippet=”download-snippet”]